PPP6C Polyclonal AntibodyPPP6C Polyclonal Antibody
Move your mouse over image or click to enlarge

PPP6C Polyclonal Antibody

Cat# Size Price Qty Buy
A4039-200ul 200ul
£332.50
A4039-100ul 100ul
£192.50
A4039-50ul 50ul
£113.75
A4039-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4039
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PPP6C; PP6; PP6C; protein phosphatase 6 catalytic subunit
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-305 of human PPP6C (NP_002712.1).
Reactivity Human, Mouse, Rat
Gene ID 5537
Calculated MW 32kDa/35kDa/38kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents