PPP3CB Polyclonal AntibodyPPP3CB Polyclonal Antibody
Move your mouse over image or click to enlarge

PPP3CB Polyclonal Antibody

Cat# Size Price Qty Buy
A3629-200ul 200ul
£332.50
A3629-100ul 100ul
£192.50
A3629-50ul 50ul
£113.75
A3629-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3629
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PPP3CB; CALNA2; CALNB; CNA2; PP2Bbeta; protein phosphatase 3 catalytic subunit beta
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 286-525 of human PPP3CB (NP_001135825.1).
Reactivity Human, Mouse
Gene ID 5532
Calculated MW 58kDa/59kDa
Observed MW 69kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents