PPP2CB Polyclonal AntibodyPPP2CB Polyclonal Antibody
Move your mouse over image or click to enlarge

PPP2CB Polyclonal Antibody

Cat# Size Price Qty Buy
A3122-200ul 200ul
£332.50
A3122-100ul 100ul
£192.50
A3122-50ul 50ul
£113.75
A3122-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3122
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PPP2CB; PP2Abeta; PP2CB; protein phosphatase 2 catalytic subunit beta
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human PPP2CB (NP_001009552.1).
Reactivity Human, Mouse, Rat
Gene ID 5516
Calculated MW 35kDa
Observed MW 36KDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents