PPP1CB Polyclonal AntibodyPPP1CB Polyclonal Antibody
Move your mouse over image or click to enlarge

PPP1CB Polyclonal Antibody

Cat# Size Price Qty Buy
A13528-200ul 200ul
£332.50
A13528-100ul 100ul
£192.50
A13528-50ul 50ul
£113.75
A13528-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13528
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PPP1CB; HEL-S-80p; PP-1B; PP1B; PP1beta; PPP1CD; NSLH2; protein phosphatase 1 catalytic subunit beta
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-327 of human PPP1CB (NP_002700.1).
Reactivity Human, Mouse, Rat
Gene ID 5500
Calculated MW 37kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents