PPIL4 Polyclonal AntibodyPPIL4 Polyclonal Antibody
Move your mouse over image or click to enlarge

PPIL4 Polyclonal Antibody

Cat# Size Price Qty Buy
A15920-20ul 20ul
£77.00
A15920-50ul 50ul
£113.75
A15920-100ul 100ul
£192.50
A15920-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15920
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PPIL4; HDCME13P; peptidylprolyl isomerase like 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 301-492 of human PPIL4 (NP_624311.1).
Reactivity Human
Gene ID 85313
Calculated MW 57kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPPNLVLKDKVKPKQDTKYDLILDEQAEDSKSSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLYERERSKKRDRSRSPKKSKDKEKSKYR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents