PPIF Polyclonal AntibodyPPIF Polyclonal Antibody
Move your mouse over image or click to enlarge

PPIF Polyclonal Antibody

Cat# Size Price Qty Buy
A3208-200ul 200ul
£332.50
A3208-100ul 100ul
£192.50
A3208-50ul 50ul
£113.75
A3208-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3208
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PPIF; CYP3; CyP-M; Cyp-D; CypD; peptidylprolyl isomerase F
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-207 of human PPIF (NP_005720.1).
Reactivity Human, Mouse
Gene ID 10105
Calculated MW 16kDa/22kDa
Observed MW 18kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 26500047
Sequence CSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents