PPAP2A Polyclonal AntibodyPPAP2A Polyclonal Antibody
Move your mouse over image or click to enlarge

PPAP2A Polyclonal Antibody

Cat# Size Price Qty Buy
A3062-200ul 200ul
£332.50
A3062-100ul 100ul
£192.50
A3062-50ul 50ul
£113.75
A3062-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3062
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PLPP1; LLP1a; LPP1; PAP-2a; PAP2; PPAP2A; phospholipid phosphatase 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PPAP2A (NP_003702.2).
Reactivity Human, Mouse, Rat
Gene ID 8611
Calculated MW 32kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents