POSTN Polyclonal AntibodyPOSTN Polyclonal Antibody
Move your mouse over image or click to enlarge

POSTN Polyclonal Antibody

Cat# Size Price Qty Buy
A14556-200ul 200ul
£332.50
A14556-100ul 100ul
£192.50
A14556-50ul 50ul
£113.75
A14556-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14556
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names POSTN; OSF-2; OSF2; PDLPOSTN; PN; periostin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 472-751 of human POSTN (NP_001129408.1).
Reactivity Mouse
Gene ID 10631
Calculated MW 80kDa/83kDa/87kDa/90kDa/93kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence CMEKGSKQGRNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVYKPIIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTGGGETEETLKKLLQEDTPVRKLQANKKVQGSRRRLREGRSQ
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents