POLR2H Polyclonal AntibodyPOLR2H Polyclonal Antibody
Move your mouse over image or click to enlarge

POLR2H Polyclonal Antibody

Cat# Size Price Qty Buy
A13339-200ul 200ul
£332.50
A13339-100ul 100ul
£192.50
A13339-50ul 50ul
£113.75
A13339-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13339
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names POLR2H; RPABC3; RPB17; RPB8; RNA polymerase II subunit H
Applications IF, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human POLR2H (NP_006223.2).
Reactivity Human, Mouse
Gene ID 5437
Calculated MW 9kDa/12kDa/13kDa/17kDa/19kDa
Observed MW 17kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200|IP,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents