PNMA2 Polyclonal AntibodyPNMA2 Polyclonal Antibody
Move your mouse over image or click to enlarge

PNMA2 Polyclonal Antibody

Cat# Size Price Qty Buy
A4448-200ul 200ul
£332.50
A4448-100ul 100ul
£192.50
A4448-50ul 50ul
£113.75
A4448-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4448
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PNMA2; MA2; MM2; RGAG2; paraneoplastic antigen Ma2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human PNMA2 (NP_009188.1).
Reactivity Human, Mouse, Rat
Gene ID 10687
Calculated MW 41kDa
Observed MW 41kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MALALLEDWCRIMSVDEQKSLMVTGIPADFEEAEIQEVLQETLKSLGRYRLLGKIFRKQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents