PMM2 Polyclonal AntibodyPMM2 Polyclonal Antibody
Move your mouse over image or click to enlarge

PMM2 Polyclonal Antibody

Cat# Size Price Qty Buy
A4026-200ul 200ul
£332.50
A4026-100ul 100ul
£192.50
A4026-50ul 50ul
£113.75
A4026-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4026
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PMM2; CDG1; CDG1a; CDGS; PMI; PMI1; PMM 2; phosphomannomutase 2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-246 of human PMM2 (NP_000294.1).
Reactivity Human, Mouse, Rat
Gene ID 5373
Calculated MW 13kDa/28kDa
Observed MW 28kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents