PLXNB3 Polyclonal AntibodyPLXNB3 Polyclonal Antibody
Move your mouse over image or click to enlarge

PLXNB3 Polyclonal Antibody

Cat# Size Price Qty Buy
A16064-20ul 20ul
£77.00
A16064-50ul 50ul
£113.75
A16064-100ul 100ul
£192.50
A16064-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16064
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PLXNB3; PLEXB3; PLEXR; PLXN6; plexin-B3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1050-1250 of human PLXNB3 (NP_001156729.1).
Reactivity Mouse
Gene ID 5365
Calculated MW 206kDa/209kDa
Observed MW 170kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RGGGRLIRVRGTGLDVVQRPLLSVWLEADAEVQASRAQPQDPQPRRSCGAPAADPQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRAHPQRVFFTLDNVQVDFASASGGQGFLYQPNPRLAPLSREGPARPYRLKPGHVLDVEGEGLNLGISKEEVRVHIGRGECLVKTLTRTHLYCEPPAHAPQPANGSGLPQFVV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents