PLP1 Polyclonal AntibodyPLP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

PLP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14251-200ul 200ul
£332.50
A14251-100ul 100ul
£192.50
A14251-50ul 50ul
£113.75
A14251-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14251
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PLP1; GPM6C; HLD1; MMPL; PLP; PLP/DM20; PMD; SPG2; proteolipid protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 145-210 of human PLP1 (NP_955772.1).
Reactivity Human, Mouse
Gene ID 5354
Calculated MW 26kDa/30kDa
Observed MW 34kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents