PLOD1 Polyclonal AntibodyPLOD1 Polyclonal Antibody
Move your mouse over image or click to enlarge

PLOD1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14044-200ul 200ul
£332.50
A14044-100ul 100ul
£192.50
A14044-50ul 50ul
£113.75
A14044-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14044
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PLOD1; EDS6; LH; LH1; LLH; PLOD; procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 488-727 of human PLOD1 (NP_000293.2).
Reactivity Mouse
Gene ID 5351
Calculated MW 83kDa/88kDa
Observed MW 125kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEVACDELVEEMEHFGQWSLGNNKDNRIQGGYENVPTIDIHMNQIGFEREWHKFLLEYIAPMTEKLYPGYYTRAQFDLAFVVRYKPDEQPSLMPHHDASTFTINIALNRVGVDYEGGGCRFLRYNCSIRAPRKGWTLMHPGRLTHYHEGLPTTRGTRYIAVSFVDP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents