PLCD4 Polyclonal AntibodyPLCD4 Polyclonal Antibody
Move your mouse over image or click to enlarge

PLCD4 Polyclonal Antibody

Cat# Size Price Qty Buy
A14154-200ul 200ul
£332.50
A14154-100ul 100ul
£192.50
A14154-50ul 50ul
£113.75
A14154-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14154
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PLCD4; phospholipase C delta 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human PLCD4 (NP_116115.1).
Reactivity Mouse
Gene ID 84812
Calculated MW 31kDa/87kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQAADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDCTSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQ
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents