PLAUR Polyclonal AntibodyPLAUR Polyclonal Antibody
Move your mouse over image or click to enlarge

PLAUR Polyclonal Antibody

Cat# Size Price Qty Buy
A1397-200ul 200ul
£332.50
A1397-100ul 100ul
£192.50
A1397-50ul 50ul
£113.75
A1397-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1397
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PLAUR; CD87; U-PAR; UPAR; URKR; plasminogen activator, urokinase receptor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-305 of human PLAUR (NP_002650.1).
Reactivity Human, Mouse, Rat
Gene ID 5329
Calculated MW 31kDa/32kDa/36kDa
Observed MW 74kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents