PLA2G16 Polyclonal AntibodyPLA2G16 Polyclonal Antibody
Move your mouse over image or click to enlarge

PLA2G16 Polyclonal Antibody

Cat# Size Price Qty Buy
A16018-20ul 20ul
£77.00
A16018-50ul 50ul
£113.75
A16018-100ul 100ul
£192.50
A16018-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16018
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PLA2G16; AdPLA; H-REV107; H-REV107-1; HRASLS3; HREV107; HREV107-1; HREV107-3; HRSL3; HRAS-like suppressor 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 68-162 of human PLA2G16 (NP_009000.2).
Reactivity Human
Gene ID 11145
Calculated MW 18kDa
Observed MW 18kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents