PLA2G12A Polyclonal AntibodyPLA2G12A Polyclonal Antibody
Move your mouse over image or click to enlarge

PLA2G12A Polyclonal Antibody

Cat# Size Price Qty Buy
A15902-20ul 20ul
£77.00
A15902-50ul 50ul
£113.75
A15902-100ul 100ul
£192.50
A15902-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15902
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PLA2G12A; GXII; PLA2G12; ROSSY; phospholipase A2 group XIIA
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLA2G12A (NP_110448.2).
Reactivity Human, Mouse
Gene ID 81579
Calculated MW 21kDa
Observed MW 17kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents