PIWIL4 Polyclonal AntibodyPIWIL4 Polyclonal Antibody
Move your mouse over image or click to enlarge

PIWIL4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13201-200ul 200ul
£332.50
A13201-100ul 100ul
£192.50
A13201-50ul 50ul
£113.75
A13201-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13201
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PIWIL4; HIWI2; MIWI2; piwi-like protein 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 260-460 of human PIWIL4 (NP_689644.2).
Reactivity Human, Mouse, Rat
Gene ID 143689
Calculated MW 52kDa/56kDa/96kDa
Observed MW 105kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGLIVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLLKKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDNIQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents