PIDD Polyclonal AntibodyPIDD Polyclonal Antibody
Move your mouse over image or click to enlarge

PIDD Polyclonal Antibody

Cat# Size Price Qty Buy
A4831-200ul 200ul
£332.50
A4831-100ul 100ul
£192.50
A4831-50ul 50ul
£113.75
A4831-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4831
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PIDD1; LRDD; PIDD; p53-induced death domain protein 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human PIDD (NP_665893.2).
Reactivity Human, Mouse, Rat
Gene ID 55367
Calculated MW 33kDa/37kDa/58kDa/66kDa/82kDa/97kDa/99kDa
Observed MW 100-110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDPQLLEATLAQL
Sensitivity WB,1:500 - 1:1000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents