PICK1 Polyclonal AntibodyPICK1 Polyclonal Antibody
Move your mouse over image or click to enlarge

PICK1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13574-200ul 200ul
£332.50
A13574-100ul 100ul
£192.50
A13574-50ul 50ul
£113.75
A13574-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13574
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PICK1; PICK; PRKCABP; PRKCA-binding protein
Applications IF, IHC
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 260-360 of human PICK1 (NP_036539.1).
Reactivity Human
Gene ID 9463
Calculated MW 39kDa/46kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI
Sensitivity IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents