PHYH Polyclonal AntibodyPHYH Polyclonal Antibody
Move your mouse over image or click to enlarge

PHYH Polyclonal Antibody

Cat# Size Price Qty Buy
A14041-200ul 200ul
£332.50
A14041-100ul 100ul
£192.50
A14041-50ul 50ul
£113.75
A14041-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14041
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PHYH; LN1; LNAP1; PAHX; PHYH1; RD; phytanoyl-CoA 2-hydroxylase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-338 of human PHYH (NP_006205.1).
Reactivity Mouse, Rat
Gene ID 5264
Calculated MW 27kDa/38kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents