PHF2 Polyclonal AntibodyPHF2 Polyclonal Antibody
Move your mouse over image or click to enlarge

PHF2 Polyclonal Antibody

Cat# Size Price Qty Buy
A16063-50ul 50ul
£113.75
A16063-20ul 20ul
£77.00
A16063-200ul 200ul
£332.50
A16063-100ul 100ul
£192.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16063
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PHF2; CENP-35; GRC5; JHDM1E; KDM7C; PHD finger protein 2
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 850-950 of human PHF2 (NP_005383.3).
Reactivity Human, Rat
Gene ID 5253
Calculated MW 120kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence AKNSVDLDDYEEEQDHLDACFKDSDYVYPSLESDEDNPIFKSRSKKRKGSDDAPYSPTARVGPSVPRQDRPVREGTRVASIETGLAAAAAKLSQQEEQKSK
Sensitivity IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents