PHC3 Polyclonal AntibodyPHC3 Polyclonal Antibody
Move your mouse over image or click to enlarge

PHC3 Polyclonal Antibody

Cat# Size Price Qty Buy
A14151-200ul 200ul
£332.50
A14151-100ul 100ul
£192.50
A14151-50ul 50ul
£113.75
A14151-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14151
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PHC3; EDR3; HPH3; polyhomeotic homolog 3
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-300 of human PHC3 (NP_079223.3).
Reactivity Human
Gene ID 80012
Calculated MW 14kDa/16kDa/19kDa/35kDa/104kDa/106kDa/107kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LSSSQLQSLAAVQASLSSGRPSTSPTGSVTQQSSMSQTSINLSTSPTPAQLISRSQASSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQMLIFTPATTVAAVQSDIPVVSSSSSSSCQSAATQVQNLTLRSQKLGVLSSSQNGPPKSTSQTQSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRSTAVTRTSSI
Sensitivity IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents