PHB2 Polyclonal AntibodyPHB2 Polyclonal Antibody
Move your mouse over image or click to enlarge

PHB2 Polyclonal Antibody

Cat# Size Price Qty Buy
A4504-200ul 200ul
£332.50
A4504-100ul 100ul
£192.50
A4504-50ul 50ul
£113.75
A4504-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4504
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PHB2; BAP; BCAP37; Bap37; PNAS-141; REA; hBAP; p22; prohibitin-2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-299 of human PHB2 (NP_001138303.1).
Reactivity Human, Mouse, Rat
Gene ID 11331
Calculated MW 29kDa/33kDa
Observed MW 32kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents