PGAM5 Polyclonal AntibodyPGAM5 Polyclonal Antibody
Move your mouse over image or click to enlarge

PGAM5 Polyclonal Antibody

Cat# Size Price Qty Buy
A16022-20ul 20ul
£77.00
A16022-50ul 50ul
£113.75
A16022-100ul 100ul
£192.50
A16022-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16022
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PGAM5; BXLBV68; serine/threonine-protein phosphatase PGAM5, mitochondrial
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-225 of human PGAM5 (NP_612642.2).
Reactivity Human, Mouse, Rat
Gene ID 192111
Calculated MW 28kDa/32kDa
Observed MW 32kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents