PFDN5 Polyclonal AntibodyPFDN5 Polyclonal Antibody
Move your mouse over image or click to enlarge

PFDN5 Polyclonal Antibody

Cat# Size Price Qty Buy
A4014-200ul 200ul
£332.50
A4014-100ul 100ul
£192.50
A4014-50ul 50ul
£113.75
A4014-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4014
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PFDN5; MM-1; MM1; PFD5; prefoldin subunit 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human PFDN5 (NP_002615.2).
Reactivity Human, Mouse, Rat
Gene ID 5204
Calculated MW 7kDa/12kDa/17kDa
Observed MW 17kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents