PEX12 Polyclonal AntibodyPEX12 Polyclonal Antibody
Move your mouse over image or click to enlarge

PEX12 Polyclonal Antibody

Cat# Size Price Qty Buy
A16062-20ul 20ul
£77.00
A16062-50ul 50ul
£113.75
A16062-100ul 100ul
£192.50
A16062-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16062
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PEX12; PAF-3; PBD3A; peroxisome assembly protein 12
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 290-359 of human PEX12 (NP_000277.1).
Reactivity Human
Gene ID 5193
Calculated MW 40kDa
Observed MW 41kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents