PEBP4 Polyclonal AntibodyPEBP4 Polyclonal Antibody
Move your mouse over image or click to enlarge

PEBP4 Polyclonal Antibody

Cat# Size Price Qty Buy
A14485-200ul 200ul
£332.50
A14485-100ul 100ul
£192.50
A14485-50ul 50ul
£113.75
A14485-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14485
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PEBP4; CORK-1; CORK1; GWTM1933; HEL-S-300; PEBP-4; PRO4408; hPEBP4; phosphatidylethanolamine-binding protein 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human PEBP4 (NP_659399.2).
Reactivity Mouse
Gene ID 157310
Calculated MW 25kDa
Observed MW 26kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKG
Sensitivity WB,1:500 - 1:1000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents