PDIA5 Polyclonal AntibodyPDIA5 Polyclonal Antibody
Move your mouse over image or click to enlarge

PDIA5 Polyclonal Antibody

Cat# Size Price Qty Buy
A14476-200ul 200ul
£332.50
A14476-100ul 100ul
£192.50
A14476-50ul 50ul
£113.75
A14476-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14476
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PDIA5; PDIR; protein disulfide-isomerase A5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-140 of human PDIA5 (NP_006801.1).
Reactivity Human, Mouse
Gene ID 10954
Calculated MW 30kDa/59kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents