PDE4D Polyclonal AntibodyPDE4D Polyclonal Antibody
Move your mouse over image or click to enlarge

PDE4D Polyclonal Antibody

Cat# Size Price Qty Buy
A13937-200ul 200ul
£332.50
A13937-100ul 100ul
£192.50
A13937-50ul 50ul
£113.75
A13937-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13937
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PDE4D; ACRDYS2; DPDE3; HSPDE4D; PDE43; PDE4DN2; STRK1; phosphodiesterase 4D
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 249-518 of human PDE4D (NP_001184152.1).
Reactivity Human, Rat
Gene ID 5144
Calculated MW 23-24kDa/57-91kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVGEEEESQPEACVIDDRSPDT
Sensitivity WB,1:500 - 1:2000|IF,1:20 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents