PCNP Polyclonal AntibodyPCNP Polyclonal Antibody
Move your mouse over image or click to enlarge

PCNP Polyclonal Antibody

Cat# Size Price Qty Buy
A14413-200ul 200ul
£332.50
A14413-100ul 100ul
£192.50
A14413-50ul 50ul
£113.75
A14413-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14413
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PCNP; PEST proteolytic signal-containing nuclear protein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human PCNP (NP_065090.1).
Reactivity Human
Gene ID 57092
Calculated MW 6kDa/13kDa/18kDa
Observed MW 19kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISKFGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents