PCDHA6 Polyclonal AntibodyPCDHA6 Polyclonal Antibody
Move your mouse over image or click to enlarge

PCDHA6 Polyclonal Antibody

Cat# Size Price Qty Buy
A4856-200ul 200ul
£332.50
A4856-100ul 100ul
£192.50
A4856-50ul 50ul
£113.75
A4856-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4856
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PCDHA6; CNR2; CNRN2; CNRS2; CRNR2; PCDH-ALPHA6; protocadherin alpha-6
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human PCDHA6 (NP_061732.1).
Reactivity Human, Mouse, Rat
Gene ID 56142
Calculated MW 75kDa/86kDa/102kDa
Observed MW 103kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MVFTPEDRLGKQCLLLPLLLLAAWKVGSGQLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRMASKDREDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVDVEVRDINDNPPLFPVEEQRVLIYESRLPDSVFPLEGASDADVGSNSILTYKLSSSEYFGLDVKINSDDNKQIGLLLKKSLDREEAPAHNLFLTATDGGKPELTGTVQLLV
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents