PAX3 Polyclonal AntibodyPAX3 Polyclonal Antibody
Move your mouse over image or click to enlarge

PAX3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13930-200ul 200ul
£332.50
A13930-100ul 100ul
£192.50
A13930-50ul 50ul
£113.75
A13930-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13930
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PAX3; CDHS; HUP2; WS1; WS3; paired box 3
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-206 of human PAX3 (NP_039230.1).
Reactivity Human, Mouse, Rat
Gene ID 5077
Calculated MW 22kDa/24kDa/44kDa/45kDa/52kDa/53kDa/55kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKDAVCDRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERGKALVSGVSSH
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents