PARVB Polyclonal AntibodyPARVB Polyclonal Antibody
Move your mouse over image or click to enlarge

PARVB Polyclonal Antibody

Cat# Size Price Qty Buy
A13161-200ul 200ul
£332.50
A13161-100ul 100ul
£192.50
A13161-50ul 50ul
£113.75
A13161-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13161
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PARVB; CGI-56; beta-parvin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PARVB (NP_037459.2).
Reactivity Human, Mouse, Rat
Gene ID 29780
Calculated MW 37kDa/41kDa/45kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents