PARN Polyclonal AntibodyPARN Polyclonal Antibody
Move your mouse over image or click to enlarge

PARN Polyclonal Antibody

Cat# Size Price Qty Buy
A4002-200ul 200ul
£332.50
A4002-100ul 100ul
£192.50
A4002-50ul 50ul
£113.75
A4002-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4002
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PARN; DAN; DKCB6; PFBMFT4; poly(A)-specific ribonuclease
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PARN (NP_002573.1).
Reactivity Human
Gene ID 5073
Calculated MW 52kDa/66kDa/67kDa/73kDa
Observed MW 73kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANS
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents