PAPD5 Polyclonal AntibodyPAPD5 Polyclonal Antibody
Move your mouse over image or click to enlarge

PAPD5 Polyclonal Antibody

Cat# Size Price Qty Buy
A15885-20ul 20ul
£77.00
A15885-50ul 50ul
£113.75
A15885-100ul 100ul
£192.50
A15885-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15885
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PAPD5; TRF4-2; poly(A) RNA polymerase D5, non-canonical
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 480-590 of human PAPD5 (NP_001035374.2).
Reactivity Human, Mouse, Rat
Gene ID 64282
Calculated MW 41kDa/51kDa/63kDa/64kDa/75kDa
Observed MW 90kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVSSSSATQSSSSDVDSDAT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents