PAK5 Polyclonal AntibodyPAK5 Polyclonal Antibody
Move your mouse over image or click to enlarge

PAK5 Polyclonal Antibody

Cat# Size Price Qty Buy
A15872-20ul 20ul
£77.00
A15872-50ul 50ul
£113.75
A15872-100ul 100ul
£192.50
A15872-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15872
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PAK5; PAK7; p21 (RAC1) activated kinase 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human PAK7 (NP_065074.1).
Reactivity Human, Mouse
Gene ID 57144
Calculated MW 80kDa
Observed MW 81kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents