PACRG Polyclonal AntibodyPACRG Polyclonal Antibody
Move your mouse over image or click to enlarge

PACRG Polyclonal Antibody

Cat# Size Price Qty Buy
A15956-50ul 50ul
£113.75
A15956-20ul 20ul
£77.00
A15956-200ul 200ul
£332.50
A15956-100ul 100ul
£192.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15956
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PACRG; GLUP; HAK005771; PARK2CRG; parkin coregulated
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human PACRG (NP_001073847.1).
Reactivity Human, Mouse, Rat
Gene ID 135138
Calculated MW 29kDa/33kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents