P4HA3 Polyclonal AntibodyP4HA3 Polyclonal Antibody
Move your mouse over image or click to enlarge

P4HA3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13767-200ul 200ul
£332.50
A13767-100ul 100ul
£192.50
A13767-50ul 50ul
£113.75
A13767-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13767
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names P4HA3; prolyl 4-hydroxylase subunit alpha-3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human P4HA3 (NP_878907.1).
Reactivity Human, Mouse, Rat
Gene ID 283208
Calculated MW 28kDa/61kDa/67kDa
Observed MW 61kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEARLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEAS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents