p38 MAPK Polyclonal Antibodyp38 MAPK Polyclonal Antibody
Move your mouse over image or click to enlarge

p38 MAPK Polyclonal Antibody

Cat# Size Price Qty Buy
A14401-200ul 200ul
£332.50
A14401-100ul 100ul
£192.50
A14401-50ul 50ul
£113.75
A14401-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14401
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MAPK14; CSBP; CSBP1; CSBP2; CSPB1; EXIP; Mxi2; PRKM14; PRKM15; RK; SAPK2A; p38; p38ALPHA; mitogen-activated protein kinase 14
Applications IF, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human p38 MAPK (NP_620581.1).
Reactivity Human, Mouse, Rat
Gene ID 1432
Calculated MW 29kDa/34kDa/35kDa/41kDa
Observed MW 41kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Sensitivity WB,1:500 - 1:1000|IF,1:50 - 1:100|IP,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents