P2RY4 Polyclonal AntibodyP2RY4 Polyclonal Antibody
Move your mouse over image or click to enlarge

P2RY4 Polyclonal Antibody

Cat# Size Price Qty Buy
A3059-200ul 200ul
£332.50
A3059-100ul 100ul
£192.50
A3059-50ul 50ul
£113.75
A3059-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3059
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names P2RY4; NRU; P2P; P2Y4; UNR; P2Y purinoceptor 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 286-365 of human P2RY4 (NP_002556.1).
Reactivity Human, Mouse, Rat
Gene ID 5030
Calculated MW 40kDa
Observed MW 41kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VVYKVTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTPRADRL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents