OTUD6B Polyclonal AntibodyOTUD6B Polyclonal Antibody
Move your mouse over image or click to enlarge

OTUD6B Polyclonal Antibody

Cat# Size Price Qty Buy
A14511-200ul 200ul
£332.50
A14511-100ul 100ul
£192.50
A14511-50ul 50ul
£113.75
A14511-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14511
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names OTUD6B; CGI-77; DUBA-5; DUBA5; IDDFSDA; OTU domain containing 6B
Applications IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-323 of human OTUD6B (NP_057107.3).
Reactivity Human, Mouse, Rat
Gene ID 51633
Calculated MW 21kDa/33kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENCS
Sensitivity WB,1:500 - 1:2000|IP,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents