OSBPL10 Polyclonal AntibodyOSBPL10 Polyclonal Antibody
Move your mouse over image or click to enlarge

OSBPL10 Polyclonal Antibody

Cat# Size Price Qty Buy
A13199-200ul 200ul
£332.50
A13199-100ul 100ul
£192.50
A13199-50ul 50ul
£113.75
A13199-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13199
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names OSBPL10; ORP10; OSBP9; oxysterol binding protein like 10
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-400 of human OSBPL10 (NP_060254.2).
Reactivity Human, Mouse, Rat
Gene ID 114884
Calculated MW 77kDa/83kDa
Observed MW 100kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ASPCSQRHLSVGAPGVVTITHHKSPAAARRAKSQYSGQLHEVREMMNQVEGQQKNLVHAIESLPGSGPLTALDQDLLLLKATSAATLSCLGECLNLLQQSVHQAGQPSQKPGASENILGWHGSKSHSTEQLKNGTLGSLPSASANITWAILPNSAEDEQTSQPEPEPNSGSELVLSEDEKSDNEDKEETELGVMEDQRSII
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents