OR2T10 Polyclonal AntibodyOR2T10 Polyclonal Antibody
Move your mouse over image or click to enlarge

OR2T10 Polyclonal Antibody

Cat# Size Price Qty Buy
A15948-20ul 20ul
£77.00
A15948-50ul 50ul
£113.75
A15948-100ul 100ul
£192.50
A15948-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15948
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names OR2T10; OR1-64; olfactory receptor 2T10
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OR2T10 (NP_001004693.1).
Reactivity Human, Mouse
Gene ID 127069
Calculated MW 35kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MRLANQTLGGDFFLLGIFSQISHPGRLCLLIFSIFLMAVSWNITLILLIHIDSSLHTPMYFFINQLSLIDLTYISVTVPKMLVNQLAKDKTISVLGCGTQ
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents