NVL Polyclonal AntibodyNVL Polyclonal Antibody
Move your mouse over image or click to enlarge

NVL Polyclonal Antibody

Cat# Size Price Qty Buy
A3995-200ul 200ul
£332.50
A3995-100ul 100ul
£192.50
A3995-50ul 50ul
£113.75
A3995-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3995
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NVL; NVL2; nuclear VCP-like
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 340-520 of human NVL (NP_001230076.1).
Reactivity Human, Mouse
Gene ID 4931
Calculated MW 72kDa/73kDa/82kDa/85kDa/95kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence CLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLTPGFVGADLMALCREAAMCAVNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents