NUTF2 Polyclonal AntibodyNUTF2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NUTF2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13576-200ul 200ul
£332.50
A13576-100ul 100ul
£192.50
A13576-50ul 50ul
£113.75
A13576-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13576
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NUTF2; NTF-2; NTF2; PP15; nuclear transport factor 2
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human NUTF2 (NP_005787.1).
Reactivity Human, Rat
Gene ID 10204
Calculated MW 14kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents