NUR77 Polyclonal AntibodyNUR77 Polyclonal Antibody
Move your mouse over image or click to enlarge

NUR77 Polyclonal Antibody

Cat# Size Price Qty Buy
A13316-200ul 200ul
£332.50
A13316-100ul 100ul
£192.50
A13316-50ul 50ul
£113.75
A13316-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13316
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NR4A1; GFRP1; HMR; N10; NAK-1; NGFIB; NP10; NUR77; TR3; nuclear receptor subfamily 4 group A member 1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NUR77 (NP_775180.1).
Reactivity Human, Mouse
Gene ID 3164
Calculated MW 33kDa/64kDa/65kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents