NUP93 Polyclonal AntibodyNUP93 Polyclonal Antibody
Move your mouse over image or click to enlarge

NUP93 Polyclonal Antibody

Cat# Size Price Qty Buy
A4333-200ul 200ul
£332.50
A4333-100ul 100ul
£192.50
A4333-50ul 50ul
£113.75
A4333-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4333
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NUP93; NIC96; NPHS12; nucleoporin 93
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 670-819 of human NUP93 (NP_055484.3).
Reactivity Human, Mouse, Rat
Gene ID 9688
Calculated MW 79kDa/93kDa
Observed MW 93kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLVPLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents