NUP43 Polyclonal AntibodyNUP43 Polyclonal Antibody
Move your mouse over image or click to enlarge

NUP43 Polyclonal Antibody

Cat# Size Price Qty Buy
A15983-20ul 20ul
£77.00
A15983-50ul 50ul
£113.75
A15983-100ul 100ul
£192.50
A15983-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15983
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NUP43; bA350J20.1; p42; nucleoporin 43
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-260 of human NUP43 (NP_942590.1).
Reactivity Human, Rat
Gene ID 348995
Calculated MW 31kDa/42kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAH
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents